Adipotide Pnc-27 Peptide P21 P021 Mots-C Ara 290 Ll-37 Ftpp B7-33

• CAS No.: 910463-68-2
• Formula: 910463-68-2
• Variety: Powder
• Feature: Eco-Friendly
• Usage: Organic Chemical Material
• Status: Solid State
• Model NO.: PNC-27
• State: Solid
• Purity: >99%
• Type a: Pharmaceutical Intermediates
• Transport Package: Box Packing
• Specification: 2mg, 5mg, 10mg
• Trademark: OEM service
• Origin: China
• Production Capacity: 5000box Per Week

Product Description

 

PNC-27 is an anticancer peptide, containing an HDM-2-binding domain. PNC-27 shows anti-tumor activity and can be used in acute myeloid leukemia research.
 

CAS	1159861-00-3
M.W/Mr.	4029.2
Purity	99%
Sequence	PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG

PNC-27 is a membrane-active peptide that binds to the HDM-2 protein expressed in the cancer cell membranes of solid tissue tumor cells and induces transmembrane pore formation in cancer, but not in normal cells, resulting in tumor cell necrosis that is independent of p53 activity in these cells. 

PNC-27 is a peptide that contains p53 protein amino acid residues 12-26 of its HDM-2 binding domain attached to a transmembrane-penetrating sequence, also called the membrane residency peptide (MRP). Both PNC-27 and PNC-28 (which has a sequence that is identical to that of PNC-27 but lacks the first six amino acid residues of PNC-27 (i.e., p53 residues 17-26) are lethal to a wide variety of cancer cells with IC50 values ranging from around 75 ug/ml (18.6 uM) to 200 ug/ml (50 uM). On the other hand, neither peptide affects normal or untransformed cells in culture, including human hematopoietic stem cells even at the highest doses (around 500 ug/ml) tested. The latter finding suggests that both peptides would not be toxic to bone marrow function in contrast to the effects of many chemotherapeutic agents.

 

Physical Characters and specifications

Product name	PNC-27
Other name	N/A
Appearance	White powder
Purity	95%MIN (HPLC)
Package	100mg, 1g
Grade	Cosmetic grade

For scientific research use only. Not for human consumption.

If need FITC free, please contact with us before payment.

Name: PNC-27
Sequence:  PPLSQETFSDLWKLL
Molecular formula: C84H128N18O24
Molecular weight: 1772.93
Purity:  95.0% min
Source :  synthetic

Storage
Stored in a freezer at or below -9C.
After reconstitution, peptide should be kept refrigerated.